Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2071 Peroxiredoxin, bacterioferritin comigratory protein homolog (bcp-1) 
MVKVGDKAPLFEGIADNGEKISLSDYIGKHNIVLYFYPKDDTPGCTREACAFRDNWDLLKDYDVVVIGVSSDDINSHKRF
KEKYKLPFILVSDPDKKIRELYGAKGFILPARITFVIDKKGIIRHIYNSQMNPANHVNEALKALKQIKEEEIS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898858 Gene name: bcp-1 COG: O COG1225 Peroxiredoxin Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2071 hypothetical 1 bcp-1 Peroxiredoxin, bacterioferritin comigratory protein homolog Cellular Processes 1 single function Multicopy. Similar to SSO2255, SSO2613, SSO2121 Detoxification 04/22/01 00:00:00 terminal status:good O COG1225 Posttranslational modification, protein turnover, chaperones Peroxiredoxins

CROSS REFERENCES:
pI: 8,11
MW: 17459,94
GenBank: 13815355
SCOP superfamily: => 
SCOP assignment: 2-147 4.0e-42 Thioredoxin-like