Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2072 hypothetical protein SSO2072 
MMIFRQIISKSGGCATYVFGCTQAGELFVVDPKYEMVDEIIELARDLGDMKIAYIIDTHTHADHLSGAKKLASLTNANVY
YHELSQVKFKVERVKNGEEIKAGNVKIKVLHTPGHTPDSISVLIYDRRRDESWNEPWAILTGDTLFVGGLGRIDIGGENA
EENLYYSLAKLKELPDYVEIYPAHTAGSVCGIGISGKPSSTIGFEKRFNSLFRINNKDEFVNRIREVKMPKPKEFDDYIR
KNLEGVI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898859 Gene name: - COG: R COG0491 Zn-dependent hydrolases, including glyoxylases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2072 hypothetical 1 Conserved hypothetical protein 1 single function 04/22/01 00:00:00 terminal status:good R COG0491 General function prediction only Zn-dependent hydrolases, including glyoxylases

CROSS REFERENCES:
pI: 6,63
MW: 27805,57
GenBank: 13815358
SCOP superfamily: => 
SCOP assignment: 2-244 1.2e-42 Metallo-hydrolase