Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2143 Second ORF in transposon ISC1316 
MVVKLTRSERIYITFVVDHEFPKLPNTGKEVAIDVGIEKLIVTSDGEYFPNLRPLEKALWKVKHLHRELSRKKFLSNNWF
KAKVKLARAYEHLKNLRRDLYMKLGKWFAEHYDVAVMEGIHVKQLIGKSLRSLRRRLSDVAFSELRDLIKYQLEKYGKKL
ILVNPAYTSKTCAKCGYVKEDLSLSDRVFVCPNCGWIADRDYNASLNILRGSG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898926 Gene name: - COG: L COG0675 Transposase and inactivated derivatives Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2143 hypothetical 1 second ORF in transposon ISC1316 1 single function 04/22/01 00:00:00 terminal status:good L COG0675 DNA replication, recombination and repair Predicted transposases

CROSS REFERENCES:
pI: 10,51
MW: 24790,81
GenBank: 13815439