Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2160 hypothetical protein SSO2160 
MSTDFLTTREKIFLLLFYSDEPLSAREIMRRLDVRKEKEVYDHLEHLARSSKRKGYMLIIIPAKCKSCGYVFNSDKIKKP
SRCPICKSEKIEMPKFLIRNK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898941 Gene name: - COG: K COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2160 hypothetical 1 Conserved hypothetical protein 1 single function Similarity with PAB3329, AF2182 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 10,41
MW: 12002,12
GenBank: 13815456
SCOP superfamily: => 
SCOP assignment: 64-90 6.4e-03 Rubredoxin-like