Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2163 Histidine triad (Hit) family protein, putative 
MCIFCNIVEGRDHGYIVYSNDRVVAFLDKFPITPGHTLVVPRTHYENFLEISEDVIPYLCTAVRKISIAVKKALKADGIR
ILTNIGKSAGQVVFHSHFHIVPTWSQDPDIMKDFVPRKEQSREYYEYVQKAIIETLKNI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898944 Gene name: - COG: FGR COG0537 Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2163 hypothetical 1 Histidine triad (Hit) family protein, putative Uncategorized 1 single function 04/22/01 00:00:00 terminal status:good F COG0537 Nucleotide transport and metabolism Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases

CROSS REFERENCES:
pI: 7,98
MW: 16010,43
GenBank: 13815459
SCOP superfamily: => 
SCOP assignment: 1-134 1.1e-38 HIT-like