Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2171 hypothetical protein SSO2171 
MLEESKNALRVFITGNPGVGKTTILLFLINKLSENNYKVAGFYCPEVRENGRRIGFRIVDITTNEGDWLAKENAPGRVKI
GKYTVLEDSAKRITEITLSNINKADVLAIDEIGPMELKIPTIKKLIETILNNQKPLIAVLHRTQKPMGGRIYVITVENRD
SIKYEILNYILSSLD

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898951 Gene name: - COG: F COG1618 Predicted nucleotide kinase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2171 hypothetical 1 Conserved hypothetical protein 1 single function Contains an ATP/GTP binding site motif A (P loop) at Amino terminus. Similarity with MJ1559, APE0781, PH0792, PAB1537, TM0036, AF0814, MTH1068 04/22/01 00:00:00 terminal status:good R COG1618 General function prediction only Predicted ATPases or kinases

CROSS REFERENCES:
pI: 9,87
MW: 19729,8
GenBank: 13815468
SCOP superfamily: => 
SCOP assignment: 10-175 3.5e-10 P-loop containing nucleotide triphosphate hydrolases