Sulfolobus solfataricus P2 >SSO2218 hypothetical protein SSO2218 MHIIFDTSGFLSGLQLSLDRVYTTQEVINEIKDKYSRFNLEIAISSGKVIIMKPSTRSVEKVTKVLNLTKERKLSNTDIS VIALALDLQPSIVFTDDLSVQNILKQLGIQFSSVKINKKVEKSFKFKYVCVNCKREFNIDHGECPYCGGKVVKRRIME15898992 Gene name: - COG: R COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2 __________
|
|
CROSS REFERENCES: pI: 10,03 MW: 17993,94 GenBank: 13815517 SCOP superfamily: => SCOP assignment: 129-154 2.2e-03 PFL-like glycyl radical enzymes