Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2218 hypothetical protein SSO2218 
MHIIFDTSGFLSGLQLSLDRVYTTQEVINEIKDKYSRFNLEIAISSGKVIIMKPSTRSVEKVTKVLNLTKERKLSNTDIS
VIALALDLQPSIVFTDDLSVQNILKQLGIQFSSVKINKKVEKSFKFKYVCVNCKREFNIDHGECPYCGGKVVKRRIME

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898992 Gene name: - COG: R COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2218 hypothetical 1 Conserved hypothetical protein 1 single function Similarity with PH0709, PAB0882, MTH1862, MJ1474, AF0385 04/22/01 00:00:00 terminal status:good J COG1439 Translation, ribosomal structure and biogenesis Ribosomal protein S15A

CROSS REFERENCES:
pI: 10,03
MW: 17993,94
GenBank: 13815517
SCOP superfamily: => 
SCOP assignment: 129-154 2.2e-03 PFL-like glycyl radical enzymes