Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2273 hypothetical protein SSO2273 
MRVDSQMSNLSRREFSYLLTIKRYNDSGEGAKINRIAKDLKIAPSSVFEEVSHLEEKGLVKKKEDGVWITNNGTRSINYL
IKAHRVIEILLVNIGIDKQTACEYSKQFDYLIPEEIIDKLYNYLGKPSYCPHGLEIPL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899040 Gene name: - COG: K COG1321 Mn-dependent transcriptional regulator Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2273 hypothetical 1 Conserved hypothetical protein 1 single function 04/22/01 00:00:00 terminal status:good R COG1321 General function prediction only Predicted iron-dependent transcription repressor

CROSS REFERENCES:
pI: 8,1
MW: 15878,12
GenBank: 13815573
SCOP superfamily: => 
SCOP assignment: 70-138 3.7e-11 Iron-dependent represor protein, dimerization domain
SCOP assignment: 28-69 9.9e-05 "Winged helix" DNA-binding domain