Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2332 hypothetical protein SSO2332 
MIRINVVGFKGGSGKSTISYHLARQLSEYYNVVLVDKTYSGTISRIYNINNNIFSFLKGRNELFYINKNNLSVINMSFLN
EDDLNGIDFNAFKYLYSKLTKDSDIVIVDHSSIPHDFATEIELKAFMENFRNFAYNTVLVLSGDEIPIKKYLNYTVLLND
FVKNYAEKILGISLPTDVKFLKIVAVIINKILKGQESKLEEFIRGDEILQRSARFIIPYYLSLTQRHFKDIDPPKEISDI
TRYILDFLREPTSIL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899091 Gene name: - COG: D COG1192 ATPases involved in chromosome partitioning Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2332 hypothetical 1 Conserved hypothetical protein 1 hypothetical Similarity with plasmid partitioning protein (ParA) 04/22/01 00:00:00 terminal status:suspect: LH D COG0455 Cell division and chromosome partitioning ATPases involved in chromosome partitioning

CROSS REFERENCES:
pI: 8,86
MW: 29528,71
GenBank: 13815632
SCOP superfamily: => 
SCOP assignment: 1-250 2.1e-12 P-loop containing nucleotide triphosphate hydrolases