Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2339 peptide chain release factor 1 
MKALIKELKKWKAPATVLLSLYIPPGRPIPDVVNLLRQEYSIAQNIKLKRTRDAVLSAIGAAIDRLNKIPKIDGNGLVLF
CGENFDTEDFKCFMFSPPDKVPLFFYRTDKEFHLEFLEDMVEDTAVYGLIIVERDEATIGLLKGARIEILEEIEGFVPGK
HMMGGQSQRRIDRIIDEMYHNFLKEVGEKVNAYFMPFVQNGKMKGVLLGGPGYAKEDFYKEDYVDYRIKNLILQPLIDVS
DQGEVGLREMIMKAEDLLKNQQYIEVEKLLEELKYHLAKDDGLIIYGKEQIKKAMEIGAIEAIVIHEDSTDKELEKLAQD
AENYGVKVFVVGDEVPEAEWVKKTFNGIVGKLRYRLY

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899097 Gene name: - COG: J COG1503 Peptide chain release factor 1 (eRF1) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2339 hypothetical 1 Eukaryotic-type peptide chain release factor (subunit 1) Translation 1 single function Translation termination, in eukaryotes: subunit-1 of heterodimer 04/22/01 00:00:00 terminal status:good J COG1503 Translation, ribosomal structure and biogenesis Peptide chain release factor eRF, subunit 1

CROSS REFERENCES:
pI: 5,08
MW: 40907,18
GenBank: 13815640
SCOP superfamily: => 
SCOP assignment: 127-259 5.9e-40 Middle domain of eukaryotic peptide chain release factor subunit 1, ERF1
SCOP assignment: 260-356 2.8e-17 eL30-like
SCOP assignment: 1-123 4.5e-35 N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1