Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2373 hypothetical protein SSO2373 
MIILFITVEDEKLEVVKKVIGKLEQFTDTKIIYDERTKTFNILPKGQNQYETLKAVSVIRAIGLGFDEQSAFRLLSDEYT
LDVIDLKALIGSNPDTIRRVKGRIIGENGKTKRIIQEYTGVDISIYGHYIGVLGPYDQVQIAKKAIELLIDGKEHSSVYK
FLDKAEKDLIIYKTSKLRRKGISEIKDNG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899129 Gene name: - COG: R COG1094 Predicted RNA-binding protein (contains KH domains) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2373 hypothetical 1 Conserved hypothetical protein 1 single function MJ0443 04/22/01 00:00:00 terminal status:good J COG1094 Translation, ribosomal structure and biogenesis Predicted RNA-binding proteins (consist of S1 domain and KH domain)

CROSS REFERENCES:
pI: 9,68
MW: 21482,72
GenBank: 13815678
SCOP superfamily: => 
SCOP assignment: 102-152 1.4e-08 KH-domain