Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2374 hypothetical protein SSO2374 
MTELPKKTKDEKRRKDEDLFKVVDSTIDYRTYLNLIQIARRLNIKEYLGAISSGKEARIYPARTFDDTYYAVKIYYTSTA
QSKRAIKKYTIGDIRFEDIKVTNTKQLINTWAKKEFKNLSRLYEAGTRVPKPILVFENVLVMEFIGENGIRAPLLKELSD
EEITQGLYEDLIQQVEIMVKGAKLIHGDLSEYNVIVYDNKCYIIDVGQAVPIDYEDAITLLKRDLDNINRFFENKGINIR
PTEELLIKYGVTGD

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899130 Gene name: - COG: TD COG1718 Serine/threonine protein kinase involved in cell cycle control Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2374 hypothetical 1 Conserved hypothetical protein 1 single function MJ0444 04/22/01 00:00:00 terminal status:suspect: LH T COG1718 Signal transduction mechanisms Predicted serine/threonine protein kinases

CROSS REFERENCES:
pI: 7,31
MW: 29470,6
GenBank: 13815679
SCOP superfamily: => 
SCOP assignment: 46-216 2.6e-08 Protein kinase-like (PK-like)