Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2375 translation initiation factor IF-1A 
MPKKDRAQEAPSRDVPRPEEGQTICVVKKMLGGDHLIVLCMDGKERLARIPGKIRKKMWMREGDVVLVGIWDFQPNRCDI
LYKYGNDEIKRLVNENIISREVIDQLRG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899131 Gene name: eiF1A COG: J COG0361 Translation initiation factor 1 (IF-1) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2375 hypothetical 1 Translation initiation factor 1A homolog (EIF 1A) (eif1A) Translation 1 single function Similar to TIF11 Translation factors 04/22/01 00:00:00 terminal status:good J COG0361 Translation, ribosomal structure and biogenesis Translation initiation factor IF-1

CROSS REFERENCES:
pI: 9,34
MW: 12517,59
GenBank: 13815680
SCOP superfamily: => 
SCOP assignment: 8-98 2.4e-27 Nucleic acid-binding proteins