Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2387 Type II secretion system protein, virB homolog (gspE-3) 
MGEWYIMSKIFKFPLQIGRGSVKQLPITDLPITLYPVTPLPEEVTTIVADYEVNILNLVPEDIKSNLTRNNIELILPNPH
VFITFDERKGIYKYVLLEPPVNEMIYNIYNIFIEEVERELLSKNPSLDLAKIIFELDKKRSGLKIIQEKRGDIYVLSTNA
RVTLYYLLRNMFGYNVLTPLVADKNIEDISVPGLNNPVYVYHRSYEYIPTNIIFTKNMQVSPQLNIMIDGEELLDQLVLR
MLSTTGKSISVAEPIQDGMLPNGDRVAATFSGRPKITSIKINL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899140 Gene name: gspE-3 COG: NU COG0630 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2387 hypothetical 1 gspE-3 Type II secretion system protein, virB homolog Transport 1 single function protein E of general secretion pathway; type II traffic warden ATPase Cell membrane transport 04/22/01 00:00:00 terminal status:good N COG0630 Cell motility and secretion Predicted ATPases involved in pili biogenesis

CROSS REFERENCES:
pI: 5,31
MW: 32380,44
GenBank: 13815689