Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2394 Molybdenum cofactor biosynthesis protein E (moaE) 
MKKVKVLYFAFIKDITHKSNEVLETECETVDCFIEQLGKIYGSELVNFLKSGINGIKVSILVNGSASTKNIKDGDEVALL
PPPSGGDLIIGKKFDLLEEIRKFREKAPPEAGSLVVYVGFVKGIVDNHRVFELKYEAYEEYTRKRFLEIKDEIKKKYNDL
IEIEIIHVIDSMKPGENVLLIMAIGKGRKDAIDAVKETLELVKHSTGIWKLEIRDDGEYWVVAGNTRVKKQ

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899146 Gene name: moaE COG: H COG0314 Molybdopterin converting factor, large subunit H COG1977 Molybdopterin converting factor, small subunit Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2394 hypothetical 1 moaE Molybdenum cofactor biosynthesis protein E Cofactor Biosynthesis 1 single function Molybdopterin 04/22/01 00:00:00 terminal status:normal H COG0314 Coenzyme metabolism Molybdopterin converting factor, large subunit

CROSS REFERENCES:
pI: 6,95
MW: 26189,25
GenBank: 13815697