Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2428 hypothetical protein SSO2428 
MTVSEEPKVIFEETLICPVCKSKTLKAVDYLYNTPHTGKLVLSNWYCENCGYKFRDVKPYETREPKLVEMKIENEDDLSA
LVYRSAFAKIVIPELGIEIEPAGMSQGYISTIEGILEILLDQVGNFCDKECEDRIRSAMEGKIKFTLIIEDESGLSFIKS
EKASTRPLILTNSD

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899177 Gene name: - COG: R COG1779 C4-type Zn-finger protein Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2428 hypothetical 1 Conserved hypothetical protein 1 single function Similar to PAB1684, APE1949, PH1223, MJ0530, MTH1834 04/22/01 00:00:00 terminal status:good R COG1779 General function prediction only C4-type Zn finger family

CROSS REFERENCES:
pI: 4,61
MW: 19714,48
GenBank: 13815732