Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2432 hypothetical protein SSO2432 
MNIGVIILAAGEGKRFGGDKLLAKIDNTPIIMRTIRIYGDLEKIIIVGKYVNEMLPLLMDQIVIYNPFWNEGISTSLKLG
LRFFKDYDAVLVALGDMPFVTKEDVNKIINTFKPNCKAVIPTHKGERGNPVLISKSLFNEIEKLRGDVGARVILNKIKIE
ELCFIECSEGVLIDIDKKEDLMRLRDFHP

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899180 Gene name: - COG: R COG2068 Uncharacterized MobA-related protein Taxon: 273057 Lineage: Archaea: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2432 hypothetical 1 Conserved hypothetical protein 1 single function Similarity with APE2223, PAB1788, AE1419, PH0980 04/22/01 00:00:00 terminal status:good H COG0746 Coenzyme metabolism Molybdopterin-guanine dinucleotide biosynthesis protein A

CROSS REFERENCES:
pI: 7,91
MW: 21376,08
GenBank: 13815735