Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2458 hypothetical protein SSO2458 
MLIISTSDIHSPRYLTEFFLALRELGNIKADLALLAGDLVERGEYLHFTPVYNALKNRVKQIVSIFGNEDFIENRKFYRE
NYSDIIWLEDEKVEIKIENRKLIIIGSEGVLEKPTLWQTSNGITEDLYMKRLEKITEMSCNSKADIKILLTHYASTFETV
FGERKSVYPHLGYRVLEELSTKGKDCLPNIAIHGHAHYAKRTLSVVKSVRVYNVALPANKRIITIHTL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899202 Gene name: - COG: R COG1409 Predicted phosphohydrolases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2458 hypothetical 1 Conserved hypothetical protein 1 single function Similarity with APE2473 04/22/01 00:00:00 terminal status:suspect: LH R COG1409 General function prediction only Predicted phosphohydrolases, Icc family

CROSS REFERENCES:
pI: 8,62
MW: 26271,13
GenBank: 13815760
SCOP superfamily: => 
SCOP assignment: 1-207 5.1e-11 Metallo-dependent phosphatases