Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2469 ABC transporter, ATP binding protein, putative 
MFENINMYTKDRELIAIVGPSGIGKSTLLRVLGGFVKPLKGEIRLLGKKVTSPTPKIALIHQSIATFPWLTALENVKLGL
KYRKLPKEEEDRLAKHMLEVVGLQGFEDFYPKQMSGGMRQRIAIARALAANPLVLLMDEPFSHLDELTAEGLRQEVHSML
FNESTTLHSVVLVSHNLSEVVELADRVYVLNGRPATVIGEVEIKLERPRNPKDESFQEYLDILYALLTPVKKGGNNNE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899211 Gene name: - COG: P COG1116 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2469 hypothetical 1 ABC transporter, ATP binding protein, putative Transport 1 single function Contains WD repeats (TRP ASP domains) signature 04/22/01 00:00:00 terminal status:check: MH P COG1116 Inorganic ion transport and metabolism ABC-type nitrate transport system, ATPase component

CROSS REFERENCES:
pI: 7,93
MW: 26682,86
GenBank: 13815770
SCOP superfamily: => 
SCOP assignment: 2-223 4.8e-52 P-loop containing nucleotide triphosphate hydrolases