Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2482 Succinyl-CoA synthetase, alpha subunit (sucD) 
MLKYGTKIVAGVTPGKGGTQVNSVPVYDTVKDAMKEHEADASIIFVPARYAVDAIYEAVDAGIKLIVTITEHIPVLDMAR
AIKYARARGARIIGPNCPGIIAPEESLVGILPARAFKKGKIGIVSRSGTLTYEVSELLKNSGMGQSTVIGIGGDPIIGTS
TLEVAKMFDQDPETEKIVVIGEIGGTMEERLAEAYKRGEIKKPIIAYIAGMTAPREKRMGHAGAVVYMGMGTFESKIRAF
KEAGIPIANTPYDIPKLLLS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899223 Gene name: sucD COG: C COG0074 Succinyl-CoA synthetase, alpha subunit Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2482 hypothetical 1 sucD Succinyl-CoA synthetase, alpha subunit Energy Metabolism 1 single function 6.2.1.5 04/22/01 00:00:00 terminal status:good C COG0074 Energy production and conversion Succinyl-CoA synthetase, alpha subunit

CROSS REFERENCES:
pI: 9,45
MW: 27733,19
GenBank: 13815783
SCOP superfamily: => 
SCOP assignment: 1-95 3.2e-29 NAD(P)-binding Rossmann-fold domains
SCOP assignment: 96-259 5.2e-44 Succinyl-CoA synthetase domains