Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2493 Lipase (lipP-1) 
MPLDPRIKELLESGFIVPIGKASVDEVRKIFRQLASAAPKVEVGKVEDIKIPGSEANINARVYLPKANGPYGVLIYLHGG
GFVIGDVESYDPLCRAITNACNCVVVSVDYRLAPEYKFPSAVIDSFDATNWVYNNLDKFDGKMGVAIAGDSAGGNLAAVV
ALLSKGKLNLKYQILIYPAVGFDSVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRFSPILVQDLSGLPPALIIT
AEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIEQGRDAIGLIGSVLRRAFYDKS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899234 Gene name: lipP-1 COG: I COG0657 Esterase/lipase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2493 hypothetical 1 lipP-1 Lipase Lipid metabolism 1 single function 3.1.1.3 High similarity with psychrotroph Pseudomonas sp. strain B11 1 lipP gene 04/22/01 00:00:00 terminal status:good I COG0657 Lipid metabolism Acetyl esterase

CROSS REFERENCES:
pI: 5,49
MW: 33433,05
GenBank: 13815796
SCOP superfamily: => 
SCOP assignment: 21-299 4.3e-62 alpha/beta-Hydrolases