Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2612 HtrA like serine protease (periplasmic) 
MYEDLVERVTPSVVTIITKQIALDQFFMPQVAEGIGSGYSIGKNILITSYHVISNAEEILVISEDGFREEAQVIAINPFH
DLAMLRSTIELPSLKLAKECKTGEVVLAVGNPLGLYSVSMGIISSEERAIMTPNGLPIYVVQTDAAVNPGNSGGPLINTR
GEVVGTVTAMIREAQNIGFAIPSKLVDSFVKNVMKFGRYIRPYVGIGVIKLNKALATYLGVRKQNGLLVTNIDPNGSAYK
YGIRRGDIILKVNNQEVKSPIDLLAVLEEMVGSQINVKMLRDSKEIELSIPVPGLST

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899338 Gene name: - COG: O COG0265 Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2612 hypothetical 1 HtrA like serine protease (periplasmic) Proteases 1 single function 3.4.21.- 04/22/01 00:00:00 terminal status:good O COG0265 Posttranslational modification, protein turnover, chaperones Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain

CROSS REFERENCES:
pI: 5,97
MW: 32202,22
GenBank: 13815918
SCOP superfamily: => 
SCOP assignment: 166-296 3.5e-13 PDZ domain-like
SCOP assignment: 2-216 3.8e-32 Trypsin-like serine proteases