Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2616 Dipeptide ABC transporter ATP binding protein (dppD-3) 
MNNMVVLQIRNLNVYYNTLISWVKVLSDVNLDVEKGEIVGVVGESGSGKSTLGHAISRILPPNARIQGDIIVDGVNLAKL
KDSELQKYRGTWVFMIFQNPLNSLNPVKKVGSQLLEAVKIRYQREGKKAEEESLMRDVIEVLKDLRLPDPYSIIDRYPHQ
LSGGQVQRIVISMALLLKPKLLIADEPTSALDVTIQAQVVNLFKQLNKEINTSILFITHDISLAYVVSDRIVVMYAGRIM
EDGKVEEVLKSPMHPYTQGLVASIPSGDKNQKLTAIPGNPPSFFALPTGCKFSNRCSKVFDICRKKEPSIIEKNGRKIRC
WLYE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899341 Gene name: dppD-3 COG: EP COG0444 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2616 hypothetical 1 dppD-3 Dipeptide ABC transporter ATP binding protein Transport 1 single function Cell membrane transport 04/22/01 00:00:00 terminal status:check: MH E COG0444 Amino acid transport and metabolism ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component

CROSS REFERENCES:
pI: 9,81
MW: 36331,11
GenBank: 13815921
SCOP superfamily: => 
SCOP assignment: 5-269 9.0e-65 P-loop containing nucleotide triphosphate hydrolases