Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2617 Dipeptide ABC transporter permease protein (dppC-3) 
MSESSGIRFMLKALIRDKAGLLGLIIVSLFLIWSLIQGILEILSSYLRKQYLGYILLPHNPFQYNLQLAFHPPSSTFLLG
TNAEGEDILSRILYALPRDAFVAIVVVFSAIIIGGILGILAGYLGGIVDEILMRVTDAFLSLPALILVIAITVPLKATFF
ATILGLAVVWWPTYARFYRAQTLRIKNMDYISAAKLSNVSRISLFYRYIFLNAIDPVLAYAALDFGNVILTYSTLAFLGI
GITPPIPELGEMAANGVTGLPQYWWWALFPGLTILIIVVGFVLLGDRLQDVVAGRIVY

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899342 Gene name: dppC-3 COG: EP COG1173 ABC-type dipeptide/oligopeptide/nickel transport systems, permease components Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2617 hypothetical 1 dppC-3 Dipeptide ABC transporter permease protein Transport 1 single function Cell membrane transport 04/22/01 00:00:00 terminal status:good E COG1173 Amino acid transport and metabolism Dipeptide/oligopeptide/nickel ABC-type transport systems, permease components

CROSS REFERENCES:
pI: 9,63
MW: 32892,75
GenBank: 13815922