Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2622 Phenylacetic acid degradation paaI protein homolog (paaI) 
MKESPFLKFLNIELEEIREGYARVSGVVAKDFLNLHNTAHGSFIFAIADAAFEYISNFSRDSVALHMDIDFRRPVKEGEK
VIAEAFEESSGKTTSLYRIIVKNEDGKLVAYVTALVYHLDN

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899347 Gene name: paaI COG: Q COG2050 Uncharacterized protein, possibly involved in aromatic compounds catabolism Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2622 hypothetical 1 paaI Phenylacetic acid degradation paaI protein homolog Cellular Processes 1 single function 04/22/01 00:00:00 terminal status:suspect: LH R COG2050 General function prediction only Uncharacterized protein PaaI, possibly involved in aromatic compounds catabolism

CROSS REFERENCES:
pI: 5,31
MW: 13690,4
GenBank: 13815930
SCOP superfamily: => 
SCOP assignment: 31-110 1.7e-02 Thioesterase/thiol ester dehydrase-isomerase