Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2688 Mercury resistance operon repressor, probable (merR) 
MEPLTNELESLFSALADGTRLRIVLFLLDKGQATVDEISKSLGKSQSLISHHMACLRNCGIVKVRKDGKFSYYSISTPEI
IELIKLSINHVKKYSQSILSCDVLAEEKGQVKLSH

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899409 Gene name: merR COG: K COG0640 Predicted transcriptional regulators Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2688 hypothetical 1 merR Mercury resistance operon repressor, probable Transcription 1 single function RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status:good K COG0640 Transcription Predicted transcriptional regulators

CROSS REFERENCES:
pI: 8,37
MW: 12805,76
GenBank: 13816007
SCOP superfamily: => 
SCOP assignment: 7-93 1.8e-19 "Winged helix" DNA-binding domain