Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2714 ABC transporter, permease 
MIKYSVPYLVYIAVFGIIPLILTFVIVGINFSGAIKSSFSVAPPPEIIYNTFFFSLFTAVVSTLLGYILAITVDIYPKKL
LILLILLPFTIPFTASALIWVISFYGGYGWFTYFLGINYDPLYFSKSALFAVSLVSAWSSVPLAFLLILASLKSIPKEIK
ESSQIDGLTLSQYYFKVAFPYSLKGILLAFLITFVLSMGNFDLPYVMTQGGPGFSTTTLPLIVYFMMFQYDNFSGGALFA
SILALIASIPAIGVALLVKSKGFRFSLPAIKIPDKIFKIIALLISLIIIIFLDFPVYWMVLVATRPNTLDFLKPPVLIPK
EFTLSYLVSSLESSVPYIISSIIVSLIVGVLTILLSSLGAYEGARKFWFWLLLLSIYLYALPSTSYIIPVYLMTSDLHLI
NTWIGLALPSAIFTASFAFWTMFNFYIDFPKVYEEAAEIDGMKNKILKLILPLSRPFLIATFVISFTFAWHLLFYPLVLS
ETPYQMNFPPTGSETATIFALNAISQGSVNWALLASSALVASLPVVIVSYVAQDYMLRGLYSGGVKGA

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899430 Gene name: - COG: G COG0395 ABC-type sugar transport system, permease component G COG1175 ABC-type sugar transport systems, permease components Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2714 hypothetical 1 ABC transporter, permease Transport 1 single function Cell membrane transport 04/22/01 00:00:00 terminal status:normal G COG1175 Carbohydrate transport and metabolism ABC-type sugar transport systems, permease components

CROSS REFERENCES:
pI: 9,78
MW: 60758,72
GenBank: 13816034