Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2725 hypothetical protein SSO2725 
MGLFKRNNPDSNKIGGLKILFTSDLHGSETAFRKFLNAALMTKADTLIIGGDLAGKSLVPIIDIGNSKFKIEDKIVGKEG
VDEIIKKYKSSGVYYTIVDQKGLTELNENRKSLDEEFKRVILERLQEWDRIAEEKLKGTNLKIYTNLGNDDPLYMFDVIT
KSERMVKCEGEIVNINGYEMITFGYVNPTPWNTPREMTEDQIYSNLKRIIEKVGNPAKTIFNLHAPPYGTNLDNAPLLDK
TLKPVVKNGEIVMTHVGSMSIRKLEEEFQPLLGIHGHIHESRAFDKINKTIIINPGSEYNLGMLHAAYIILEDNKVKTHQ
FVIG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899441 Gene name: - COG: R COG2129 Predicted phosphoesterases, related to the Icc protein Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2725 hypothetical 1 Hypothetical protein 1 single function Phosphoesterase related protein. Multicopy. Similar to SSO2085, SSO2729,SSO2237. Similarity with MJ1162, PH0305, MTH1882, PAB1249 04/22/01 00:00:00 terminal status:good R COG2129 General function prediction only Predicted phosphoesterases, related to the Icc protein

CROSS REFERENCES:
pI: 7,29
MW: 36625,96
GenBank: 13816048
SCOP superfamily: => 
SCOP assignment: 15-297 1.2e-09 Metallo-dependent phosphatases