Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2733 hypothetical protein SSO2733 
MENFISRLIACDKCPRLTQYRKSFPDNYWKKPVPPNGQIDAEIVIVGLAPAGNGGNRTGRMFTGDESSNNLANALYAVGL
SNQPFSVSKDDGLKLFNVYITSAVKCAPPQNKPNKDEIINCSVFLEEEVRILKNTKVYIALGKIAWDSLIYVFKKIGYNV
PNVRFYHGALVKVVKPDMSIIWLVGSYHPSPRNMKTGRLTINMLIEIFNTAKMLVNTKK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899448 Gene name: - COG: L COG1573 Uracil-DNA glycosylase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2733 hypothetical 1 Conserved hypothetical protein 1 single function Possibly an uracil-DNA glycosylase (COG1573) 04/22/01 00:00:00 terminal status:good L COG1573 DNA replication, recombination and repair Uracil-DNA glycosylase

CROSS REFERENCES:
pI: 10,34
MW: 24545,43
GenBank: 13816058
SCOP superfamily: => 
SCOP assignment: 32-193 1.2e-14 DNA glycosylase