Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2756 ferrodoxin oxidoreductase beta subunit 
MSLGLREILNKHNGILSGTSACPGCPENMAMRMLGMGLGKDVVLVVVAGCSSVIQGNAPYNAYNFPTVNVAFAAGPATAA
GLARAYKQKGKNVTIVVWAGDGGSADIGFASLSGAAERNDNILYLTVDNEAYMNSGGQRSGSTPFGAITTTTPEGKKENK
KNLPLLMIAHNVPYVATASVGYPHDYIEKLKKARQVEGFRYVHVLTPDPYGWLFDPSKTVEVAKLAVQTCYWPLFEYYNG
KLNISSESLHCLDRRTRRPIRDFLSIQGRFKKLTDEQIKILEQYIDNLWEKLKSMLNNP

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899471 Gene name: porB-2 COG: C COG1013 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2756 hypothetical 1 porB-2 Pyruvate synthase beta chain (Pyruvic-ferredoxin oxidoreductase beta chain) Energy Metabolism 1 single function 1.2.7.1 04/22/01 00:00:00 terminal status:good C COG1013 Energy production and conversion Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit

CROSS REFERENCES:
pI: 9,48
MW: 32787,38
GenBank: 13816087
SCOP superfamily: => 
SCOP assignment: 15-296 3.3e-85 Thiamin diphosphate-binding fold (THDP-binding)