Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2794 Oxydoreductase, putative 
MGSQQNPPLKVINMSSPQNTTTPQIKLDIRQGGVQHAPPFSLKANYAIITDLNKCFGCGGCQMSCKEWNTSGMFGPLPDL
NPYGELDVMFWLRVLYVEVGTYPQTKVYNIPINCFHCINAPCTEVCPVGATFKRTEDGIVLVDYNECIGTKYCIYACPYG
NRFFDYVEGVTKKCTHCFDRIYDPTLPPEERIPACIHGCMVQARIWANILDPTDPGTILFYDKGGFVMGPETGAQPASGY
LPWRSKYAESDVQLLSEAEYYNVWTANGVVQLGAQGNNSTYTEGNGSNSSSNS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899512 Gene name: - COG: C COG0437 Fe-S-cluster-containing hydrogenase components 1 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2794 hypothetical 1 Oxydoreductase, putative Energy Metabolism 1 single function Similar to molybdopterin oxidoreductase (iron-sulfur binding subunit) 04/22/01 00:00:00 terminal status:good C COG0437 Energy production and conversion Fe-S-cluster-containing hydrogenase components 1

CROSS REFERENCES:
pI: 5
MW: 32381,5
GenBank: 13816140
SCOP superfamily: => 
SCOP assignment: 45-177 1.7e-15 4Fe-4S ferredoxins