Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2826 hypothetical protein SSO2826 
MRLTNRRDFLKLLLISSSLLVLGRLSISEMQHAQNGLTPFGSWYVVQYSQIVPDIMLNNYVLTVDGEIENPLKLTYQDLL
NMPSIEVKDTIQCVSDPYFLRANVLWKGIPLSYVIDMVKPKSNVIKVVGYGADGYTADLPIEKAKEPNVLIAYMADDKPL
PQVHGYPVRLVVPGWWGYTYVKWLVRLHFTSKNILGYWESLGYPDYAKK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899541 Gene name: - COG: R COG2041 Sulfite oxidase and related enzymes Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2826 hypothetical 1 Conserved hypothetical protein 1 single function 04/22/01 00:00:00 terminal status:good R COG2041 General function prediction only Uncharacterized enzymes, related to nitrate reductase

CROSS REFERENCES:
pI: 9,03
MW: 23902,71
GenBank: 13816178
SCOP superfamily: => 
SCOP assignment: 37-203 1.2e-44 Sulfite oxidase, middle catalytic domain