Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2836 ABC transporter, ATP binding protein (branched chain amino acid) 
MSLLKLDSVSKYFGGIKALDSVTLEIENSKFTLLIGPNGSGKSTLINVVTGIYKPDSGSIFLEDRNITGKKPHELYKLGI
VRTFQNPQIFPNLSVLDNVILGISPIKGESILRSLFKPIWLREEEELAEKAYNILKIVKLDRLWDRPARELSGGQLKLLE
IARSLMTRPRLLVMDEPLAGVNPQLAKEILNILTDLKRDIGIFVVEHRLDIVANYADYVYAMFMGKVIAKGSVNDVLNNP
TVVDAYLG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899551 Gene name: - COG: E COG0411 ABC-type branched-chain amino acid transport systems, ATPase component Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2836 hypothetical 1 ABC transporter, ATP binding protein (branched chain amino acid) Transport 1 single function 04/22/01 00:00:00 terminal status:check: MH E COG0411 Amino acid transport and metabolism High-affinity branched amino acid transport system ATPase

CROSS REFERENCES:
pI: 9,46
MW: 27679,11
GenBank: 13816191
SCOP superfamily: => 
SCOP assignment: 2-248 1.2e-61 P-loop containing nucleotide triphosphate hydrolases