Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2863 acetyl-coenzyme A synthetase 
MSVTWALPFDQKINPKLNLNRLVSITTYKEIHSQTVKDYKQFWASVASEIDWFKPWEKTLDDSNPPFYKWFVGGELNASY
LTVDRHVKSWRKNKVAIIWEGEPVDEKGNPKEVRKLTYYDLYREVNRVAYLLKEKYGLKKGDAIAIYLPMIPELPIFMLA
AARIGVVFTVVFSGFSADALASRINDAEAKLLITADGGWRRGKVVDLKGIVDKALEKTPTIKDVIVVRRIGNKVNMVEGR
DKYFDEVIKDIPQNVYVEPERMKSEDPLYILYTSGTTGKPKGIVHDIGGYMTLLHATMKWVFDIRDDDIYWCTADIGWVT
GHSYIVFGPLMEGATEIMYEGALDYPQPDRWVSIIERYGITILYTSPTAIRSFMKYGDNWVKAHITSTVRLMHSVGEPIN
PEAWEWLWKLVGREEVPFGSTWWMTETGGILISHLPGLYLVPMKPGTNGPPILGIEPDVVNEDGKQVNLEERGYLVIKNP
WPGMPLTIYKDPERYVKVYWSRFPGMFYVGDYAVKDKDGYFWILGRADEVIKVAGHRLGTYELESALIEHPAVAEAAVIG
VPDPVKGEVPYAFVILRQGYTPNTQLSQEILKTVRDKVGPIATIDKIFFVGKLPKTRSGKIMRRVVRAVATRAEVGDITT
LEDEASVEEIKKALEEFKAEFEKINK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899575 Gene name: acsA-9 COG: I COG0365 Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2863 hypothetical 1 acsA-9 Acetyl-CoA synthetase (acetate-CoA ligase) Lipid metabolism 1 single function 6.2.1.1 04/22/01 00:00:00 terminal status:check: MH I COG0365 Lipid metabolism Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases

CROSS REFERENCES:
pI: 6,89
MW: 75799,02
GenBank: 13816221
SCOP superfamily: => 
SCOP assignment: 57-628 2.8e-139 Firefly luciferase-like