Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2883 Second ORF in transposon ISC1225 
MSPQTVRNYVEEQGTEVIEKLLESMRRISMEILKGVKEVDISIDWTTKTWYGKPVEGLGSSAKGNSWNYATATTKYQNMV
LLLAFVPQVNGMSKDEIVKLLMEQIVGMGLKVGLVTLDAGFYTVEVLKFISQFKFVIGVPVGDVKIYEEFDGEYTTNSKR
HKKEEQVKFRLLVYGKESLRRGEDRGVLREATNLDLPKREVLKLYNKVRSPIETSYRNIKAFLPFTSSTKFIFRELIFVL
AMIFYSLYTVFKNVMTREEFRLLLILCFLDDLSDLKDFIFNLEETLINTIDLFLWR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899594 Gene name: - COG: L COG3385 FOG: Transposase and inactivated derivatives Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2883 hypothetical 1 second ORF in transposon ISC1225 1 single function ISC1225 is split by ISC1234 first ORF is SSO11362 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 8,95
MW: 34381,86
GenBank: 13816246