Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2899 hypothetical protein SSO2899 
MYKNPYGLEIYLIKGDITEIEADAIVNAANSYLQHGGGVAYAIVRKGGYIIQKESDEYVKKFGPVPVGEVAVTSAGKLKA
KYVIHAVGPRYGIEGEDKLESAIFKSLLKADELSLSSIAMPAISTGIYGYPFEICARIMANVLKGYKPKTLRKVMICLYT
KDAYDVFKSIFNSILKN

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899613 Gene name: - COG: R COG2110 Predicted phosphatase homologous to the C-terminal domain of histone macroH2A1 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2899 hypothetical 1 Conserved hypothetical protein 1 single function 04/22/01 00:00:00 terminal status:good R COG2110 General function prediction only Predicted NA binding protein/domain related to histone macroH2A1

CROSS REFERENCES:
pI: 9,69
MW: 19444,53
GenBank: 13816268