Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO3069 Arabinose ABC transporter, ATP-binding protein 
MTTIRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGYIYFDNEAVSSPRRVMMS
PEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIENKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKD
PKVLLLDEPFSNLDAQIRESARALVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIA
RLTGEINLIQAKIIENNAIIANLKVPLNNMELKGQSNIVIGLRPDDLTLSDTLLDKYIDMGIVKVKLVSYGAGIFKIVVS
PITDENIDIIVDAEEPLETGIETHLLAKPNKVKIFDLNGSNLITSKTQIIK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899774 Gene name: - COG: G COG3839 ABC-type sugar transport systems, ATPase components Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO3069 confirmed 1 Arabinose ABC transporter, ATP-binding protein Transport 1 single function Albers, S.-V., Elferink,M.G.L., Konings, W.N., Driessen, A.J.M., pers. comm. 04/22/01 00:00:00 terminal status:check: MH G COG1130 Carbohydrate transport and metabolism ABC-type sugar transport system, ATPase component

CROSS REFERENCES:
pI: 9,56
MW: 40867,22
GenBank: 13816477
SCOP superfamily: => 
SCOP assignment: 4-249 1.2e-66 P-loop containing nucleotide triphosphate hydrolases