Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO3132 hypothetical protein SSO3132 
MIVKNFITGPLATNSYLVIAGKEGVIIDAGGDMSELIQTVRKEKINIRYIIATHGHFDHIMGVNQIKRDFPSSTFLINEK
DLGLLKRASSMAQSFLNLLISDVTKPDGFVKEGDEIELGGEKLKIIETPGHTMGSICIIANGYIFTGDTLFYGTVGRTDL
GGSEKLLRESLEKLKKLPDEIIVYPGHGPFTVLGYEKVKNPFLTMDILP

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899838 Gene name: - COG: R COG0491 Zn-dependent hydrolases, including glyoxylases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO3132 hypothetical 1 Conserved hypothetical protein 1 single function COG0491: Zn-dependent hydrolases, including glyoxylases 04/22/01 00:00:00 terminal status:good R COG0491 General function prediction only Zn-dependent hydrolases, including glyoxylases

CROSS REFERENCES:
pI: 6,37
MW: 22999,54
GenBank: 13816556
SCOP superfamily: => 
SCOP assignment: 6-208 9.2e-48 Metallo-hydrolase