Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO3136 Regulatory protein, putative 
MSQEESGPFFEDFKVGQKFKSKVGRTITDVDNIWFTLLTNNSNQIHFNKDYTEKYFPGEPFNGRLVVNGFLTLTIVAGLL
VEQTSQNGFMLGIENVKFLHPVFSGDTIYAEAEVIKVRESKSRPGFGIVKIRSYGYNQKGEKLIEFDRVFMVRKRGAKWS
S

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899840 Gene name: - COG: I COG2030 Acyl dehydratase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO3136 hypothetical 1 Regulatory protein, putative Regulation 1 single function Resembles Monoamine oxidase regulatory protein 04/22/01 00:00:00 terminal status:good E COG2030 Amino acid transport and metabolism Monoamine oxidase

CROSS REFERENCES:
pI: 10,1
MW: 18419,96
GenBank: 13816561
SCOP superfamily: => 
SCOP assignment: 44-160 1.4e-02 Thioesterase/thiol ester dehydrase-isomerase