Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO3183 hypothetical protein SSO3183 
MKVVIGYDGSDHAKKALFFTLNLIKKEDEIHLVTIVKEAPRSPEQVIIQSEQRAKQMQDEVVNELGDYKIVQKILESNEV
ADSILQYCNNIGCGLIVTGSRGLTGIKKAILGSVSSALVSKSNVPVLVVK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899887 Gene name: - COG: T COG0589 Universal stress protein UspA and related nucleotide-binding proteins Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO3183 hypothetical 1 Conserved hypothetical protein 1 putative 04/22/01 00:00:00 terminal status:good T COG0589 Signal transduction mechanisms Universal stress protein UspA and related nucleotide-binding proteins

CROSS REFERENCES:
pI: 8,09
MW: 14193,43
GenBank: 13816617
SCOP superfamily: => 
SCOP assignment: 2-130 8.6e-22 ETFP adenine nucleotide-binding domain-like