Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO3206 Protein synthesis inhibitor, putative 
MKEIIFTEKAPKPIGPYSQGVKVGDILYVSGQIPVDPKTNEVVGKNIEEQTIRVIENIKAVLEAAGYMLDDVVMSFVYLK
DIKDFQRFNEVYSKYFSNKPPARVTVEVSRLPRDVLIEITVIAQKS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899908 Gene name: - COG: J COG0251 Putative translation initiation inhibitor, yjgF family Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO3206 hypothetical 1 Protein synthesis inhibitor, putative Translation 1 single function 04/22/01 00:00:00 terminal status:good J COG0251 Translation, ribosomal structure and biogenesis Putative translation initiation inhibitor

CROSS REFERENCES:
pI: 6,95
MW: 14249,48
GenBank: 13816644
SCOP superfamily: => 
SCOP assignment: 2-125 2.1e-40 YjgF-like