Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO3209 Oxidoreductase, aldo/keto reductase family 
MRLCNKDVSQIGFGTWKIGGGYWNPDYSKDSHYIEILKYVISKGINVIDTAEMYGGGHSEELVGKAIENFDRDKIFIITK
VWSNHLKYDDLIRSAKNSLKRLNAKYIDLYLIHWPNSSVPLEESLRAMEELVDQGIVNCIGVSNFDIKLLEETMSITKKY
EITANEIEYNVENKSAEKDVIPFCERNNIKVIAYSPLARGNAKNNKILEEIGRKYNKTSVQVALNYLLRRSIPIPKASSK
DHIDEILGALGWNLSDEDYERISKI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899910 Gene name: - COG: R COG0656 Aldo/keto reductases, related to diketogulonate reductase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO3209 hypothetical 1 Oxidoreductase, aldo/keto reductase family Energy Metabolism 1 single function 04/22/01 00:00:00 terminal status:good R COG0656 General function prediction only Aldo/keto reductases, related to diketogulonate reductase

CROSS REFERENCES:
pI: 6,68
MW: 30312,31
GenBank: 13816646
SCOP superfamily: => 
SCOP assignment: 4-265 4.9e-84 NAD(P)-linked oxidoreductase