Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO5140 DNA-directed RNA polymerase subunit N 
MLIPIRCFTCGSLIADKWQSFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHVDIINEVIHYTRPI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897034 Gene name: rpoN COG: K COG1644 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO5140 hypothetical 1 rpoN DNA-directed RNA polymerase, subunit N Transcription 1 single function 2.7.7.6 RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status:good K COG1644 Transcription DNA-dependent RNA polymerase, subunit N (RpoN/RPB10)

CROSS REFERENCES:
pI: 8,53
MW: 7590,9
GenBank: 13813199
SCOP superfamily: => 
SCOP assignment: 2-56 3.7e-20 RNA polymerase subunit RPB10