Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO5410 Small nuclear riboprotein protein (snRNP-1) 
MQAKVENPLKSLRTAINRIVLVKLKDGSEYIGKLEQTDGTMNLVLRDCTEIREGTSEPVAKYGRVLIRGSNILFISVDYE
TVMNSEK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897150 Gene name: snRNP-1 COG: K COG1958 Small nuclear ribonucleoprotein (snRNP) homolog Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO5410 hypothetical 1 snRNP-1 Small nuclear riboprotein protein Transcription 1 single function RNA modification 04/22/01 00:00:00 terminal status:good K COG1958 Transcription Small nuclear riboprotein (snRNP) homologs

CROSS REFERENCES:
pI: 8,4
MW: 9788,25
GenBank: 13813335
SCOP superfamily: => 
SCOP assignment: 7-78 7.4e-15 Sm motif of small nuclear ribonucleoproteins,  SNRNP