Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO5479 30S ribosomal protein S28e 
MKYLSELFIVIAGGKMSEKTQQSQGSSIIEEFGFPAEVIQILDRTGVTGEVTQVRVRVLEGRDKGRILTRNVKGPVRVGD
ILILRETEREARKITTKR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897178 Gene name: rps28E COG: J COG2053 Ribosomal protein S28E/S33 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO5479 hypothetical 1 rps28E SSU ribosomal protein S28E Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG2053 Translation, ribosomal structure and biogenesis Ribosomal protein S28E/S33

CROSS REFERENCES:
pI: 10,77
MW: 11028,75
GenBank: 13813369