Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO5542 hypothetical protein SSO5542 
MLTSRGELYLVLRAQDVLFSLTLLSGSVIKECSKFPEYRVIIPNSFEEFIKNGRNVFSKHVIAVDKRIRAGDDVIVVNEN
DS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897215 Gene name: - COG: O COG1370 Prefoldin, molecular chaperone implicated in de novo protein folding, alpha subunit Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO5542 hypothetical 1 Conserved hypothetical protein 1 single function Some similarity with AF0708 04/22/01 00:00:00 terminal status:good J COG1370 Translation, ribosomal structure and biogenesis Predicted RNA-binding proteins (contain PUA domain)

CROSS REFERENCES:
pI: 7,3
MW: 9301,63
GenBank: 13813412