Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO5576 DNA-directed RNA polymerase, putative subunit M (rpoM-like) 
MKKETRIAVFVKVNYLYAICVFRGNFLEKMFLDINQDNLIKQITTSSIVDEIKYSNIGIGENFKEQVLEKICENLIKKLS
EKLNIDKVNG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897235 Gene name: rpoM-like COG: Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO5576 hypothetical 1 rpoM-like DNA-directed RNA polymerase, putative subunit M Transcription 1 single function 2.7.7.6 Possible in-frame shift with SSO0291. Similar to amino-end of RPOM_SULAC RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 8,63
MW: 10446,19
GenBank: 13813434