Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO5577 DNA-directed RNA polymerase, subunit L (rpoL) 
MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMT
SHYIDEIKGLTK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897236 Gene name: rpoL COG: K COG1761 DNA-directed RNA polymerase, subunit L Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO5577 hypothetical 1 rpoL DNA-directed RNA polymerase, subunit L Transcription 1 single function 2.7.7.6 RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status:good K COG1761 Transcription DNA-directed RNA polymerase, subunit L (RPC19)

CROSS REFERENCES:
pI: 6,26
MW: 10284,72
GenBank: 13813435
SCOP superfamily: => 
SCOP assignment: 1-82 1.7e-16 Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain