Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO5761 tRNA pseudouridine synthase subunit A (truB) 
MILNDFIYKIDNFCGYKNEWKIRKDSETSDKYGYYPEKRPIEIHIKNSIINLDKPPGPTSHEVAYWVKKMLNVTKAGHGG
TLEPIHWAG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897326 Gene name: truB COG: J COG0130 Pseudouridine synthase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO5761 hypothetical 1 truB tRNA pseudouridine synthase subunit A Translation 1 multifunctional 4.2.1.70 It may also have a function in cell cycle, it is a cbf5 homolog Aminoacyl tRNA synthetases 04/22/01 00:00:00 terminal status:good J COG0130 Translation, ribosomal structure and biogenesis Pseudouridine synthase

CROSS REFERENCES:
pI: 9,15
MW: 10350,8
GenBank: 13813543