Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO6206 hypothetical protein SSO6206 
MAIRRLVLDVLKPIRGTSIVDLAERISKLDGVEGVNISVTDMDVETMGLMIIIEGTSLNFDDIRKMLEEEGCAIHSIDEV
VSGNRIIEGKIKDDL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897504 Gene name: - COG: S COG1888 Uncharacterized protein conserved in archaea Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO6206 hypothetical 1 Conserved hypothetical protein 1 single function Similarity with APES031, Ta1183, MJ0319, PH1931, PAB1228,MTH889, AF1549 04/22/01 00:00:00 terminal status:good S COG1888 Function unknown Uncharacterized ArCR

CROSS REFERENCES:
pI: 4,33
MW: 10483,06
GenBank: 13813751